Wholesale/Supplier High quality/High cost performance Tirzepatide Ll 37 Peptides GLP-1 Kpv Semaglutide Ghk-Cu Thymalin Adipotide Semax Thymosin Alpha 1 Mots-C Epithalon HMG Mt2

Min.Order: 20
Product origin: Zhuzhou, Hunan, China
Infringement complaint: complaintComplaint
US$ 16 ~ 18

Description

Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Specifications

Chemistry
Sequence one letter code
  • [LL-37, 37 aa]
Sequence three letter code
  • H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS registry number
  • 154947-66-7
Molecular Formula
  • C205H340N60O53
Molecular Mass/ Weight
  • 4493.6





 

Product Tag:
Related categories:
Scroll to Top