Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder

Min.Order: 1
Product origin: Wuhan, Hubei, China
Infringement complaint: complaintComplaint
US$ 699 ~ 775

Description
We can provide lyophilized powder or raw powder for you, and the above is the price of lyophilized powder. If you have interestes in raw powder, you can contact me(Wicker: Andy1226) for the price of the raw powder.
 

Physical Characters and specifications

Supply FOXO4-DRI raw powder and freeze powder in vials.

NameFOXO4 DRI
CASN/A
Grade StandardInjection grade
COAPls contact with Senwayer freely
MOQ10mg
AppearanceWhite powder
Purity, % (by RP-HPLC)95%
Activity unitN/A
pH valueN/A
Isoelectric pointN/A
Water residueN/A
Identification testN/A
Storage2 - 8 degree
EXP time2 years
 

Product description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Contact for more product and  We also supply 
Related products:
 
No.Product NameCAS No.
 Anti-wrinkle & Anti-aging Series 
1Acetyl Hexapeptide-8616204-22-9
2 Acetyl Octapeptide-3/Snap-8868844-74-0
3Palmitoyl Tripeptide-5  /Collagen Peptide623172-56-5
4Palmitoyl Pentapeptide-4 /Matrixyl Acetate214047-00-4
5 Pentapeptide-18 /Leuphasyl64963-01-5
6Hexapeptide-10/Serilesine146439-94-3
7Palmitoyl Hexapeptide / Lipopeptide Acetate171263-26-6
8 Palmitoyl Tripeptide-1147732-56-7
9Pentapeptide-3/Vialox Peptide  135679-88-8
10Acetyl Tetrapeptide-2757942-88-4
11Acetyl Tetrapeptide-9928006-50-2
12L-Carnosine305-84-0
13Decorinyl/Tripeptide-10 Citrulline960531-53-7
14Palmitoyl Tripeptide-381447824-23-8
15Acetyl Decapeptide-3935288-50-9
16Hexapeptide-11--------
Whitening & Freckle Removing Series 
1Nonapeptide-1/Melitane158563-45-2
2Tetrapeptide-30 ---------
3Decapeptide-12 ---------
4Hexapeptide-2 ---------
5Melanostatin DM123689-72-5
6Oligopeptide-681206525-47-4
 Eye Care and Hair Growth Series 
1Acetyl Tetrapeptide-5/Eyeseryl820959-17-9
2Myristoyl Pentapeptide-17959610-30-1
3Myristoyl Tetrapeptide-12959610-24-3
4Acetyl Tetrapeptide-3/Capixyl155149-79-4
5Biotinoyl Tripeptide-1299157-54-3
6Melitane/Acetyl Hexapeptide-1448944-47-6
7Myristoyl Pentapeptide-4  ---------
Anti-allergic & Skin Repair Series 
1Pal-Tetrapeptide-7 /Pal-Tetrapeptide-3221227-05-0
2Copper Peptide49557-75-7
3Hexapeptide-91228371-11-6
4Palmitoyl Tripeptide-8936544-53-5
5Oligopeptide-10 ---------
6LZ1 Peptide ---------
Breast Series 
1Acetyl Hexapeptide-381400634-44-7
Weight Loss series 
1Acetyl Hexapeptide-39 ---------
 

Related Products

NameCAS No.Name CAS No. 
Thymalfasin69440-99-9Enfuvirtide (T-20) Acetate159519-65-0
Thymopentin Acetate (TP-5)69558-55-0Angiotensin Acetate58-49-1
Octreotide Acetate83150-76-9Somatostatin51110-01-1
Melanotan II Acetate121062-08-6Vapreotide Acetate103222-11-3
Melanotan I Acetate75921-69-6Dy norphin A (1-13)72957-38-1
Secretin Acetate17034-35-4Leuprolide53714-56-0
Ornipressin Acetate3397-23-7Eledoisin Acetate69-25-0
Oxytocin Acetate50-56-6GLP-1 (7-37) Acetate106612-94-6
Lypressin Acetate50-57-7PramlintidePramlintide
Nesiritide Acetate114471-18-0Aviptadil Acetate40077-57-4
Calcitonin (Salmone) Acetate47931-85-1Exenatide Acetate141732-76-5

Customized Service

 

FAQ

Q1:Can i get free sample ?
A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .
 

Q2:Which payment method you accept?
A: We accept bank transfer,western union, money gram,bitcoin, USDT,Credit card etc. and more bigger order we accept L/C at sight
 

Q3: Can i get tracking number after shipment ? and how long does the shipping take?
A: After shipment we will offer you tracking and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery
 

Q4: How can you guarantee the quality ?
A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.

 

Product Tag:
Related categories:
Scroll to Top