Physical Characters and specifications
Supply FOXO4-DRI raw powder and freeze powder in vials.
Name | FOXO4 DRI |
CAS | N/A |
Grade Standard | Injection grade |
COA | Pls contact with Senwayer freely |
MOQ | 10mg |
Appearance | White powder |
Purity, % (by RP-HPLC) | 95% |
Activity unit | N/A |
pH value | N/A |
Isoelectric point | N/A |
Water residue | N/A |
Identification test | N/A |
Storage | 2 - 8 degree |
EXP time | 2 years |
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
No. | Product Name | CAS No. |
Anti-wrinkle & Anti-aging Series | ||
1 | Acetyl Hexapeptide-8 | 616204-22-9 |
2 | Acetyl Octapeptide-3/Snap-8 | 868844-74-0 |
3 | Palmitoyl Tripeptide-5 /Collagen Peptide | 623172-56-5 |
4 | Palmitoyl Pentapeptide-4 /Matrixyl Acetate | 214047-00-4 |
5 | Pentapeptide-18 /Leuphasyl | 64963-01-5 |
6 | Hexapeptide-10/Serilesine | 146439-94-3 |
7 | Palmitoyl Hexapeptide / Lipopeptide Acetate | 171263-26-6 |
8 | Palmitoyl Tripeptide-1 | 147732-56-7 |
9 | Pentapeptide-3/Vialox Peptide | 135679-88-8 |
10 | Acetyl Tetrapeptide-2 | 757942-88-4 |
11 | Acetyl Tetrapeptide-9 | 928006-50-2 |
12 | L-Carnosine | 305-84-0 |
13 | Decorinyl/Tripeptide-10 Citrulline | 960531-53-7 |
14 | Palmitoyl Tripeptide-38 | 1447824-23-8 |
15 | Acetyl Decapeptide-3 | 935288-50-9 |
16 | Hexapeptide-11 | -------- |
Whitening & Freckle Removing Series | ||
1 | Nonapeptide-1/Melitane | 158563-45-2 |
2 | Tetrapeptide-30 | --------- |
3 | Decapeptide-12 | --------- |
4 | Hexapeptide-2 | --------- |
5 | Melanostatin DM | 123689-72-5 |
6 | Oligopeptide-68 | 1206525-47-4 |
Eye Care and Hair Growth Series | ||
1 | Acetyl Tetrapeptide-5/Eyeseryl | 820959-17-9 |
2 | Myristoyl Pentapeptide-17 | 959610-30-1 |
3 | Myristoyl Tetrapeptide-12 | 959610-24-3 |
4 | Acetyl Tetrapeptide-3/Capixyl | 155149-79-4 |
5 | Biotinoyl Tripeptide-1 | 299157-54-3 |
6 | Melitane/Acetyl Hexapeptide-1 | 448944-47-6 |
7 | Myristoyl Pentapeptide-4 | --------- |
Anti-allergic & Skin Repair Series | ||
1 | Pal-Tetrapeptide-7 /Pal-Tetrapeptide-3 | 221227-05-0 |
2 | Copper Peptide | 49557-75-7 |
3 | Hexapeptide-9 | 1228371-11-6 |
4 | Palmitoyl Tripeptide-8 | 936544-53-5 |
5 | Oligopeptide-10 | --------- |
6 | LZ1 Peptide | --------- |
Breast Series | ||
1 | Acetyl Hexapeptide-38 | 1400634-44-7 |
Weight Loss series | ||
1 | Acetyl Hexapeptide-39 | --------- |
Name | CAS No. | Name | CAS No. |
Thymalfasin | 69440-99-9 | Enfuvirtide (T-20) Acetate | 159519-65-0 |
Thymopentin Acetate (TP-5) | 69558-55-0 | Angiotensin Acetate | 58-49-1 |
Octreotide Acetate | 83150-76-9 | Somatostatin | 51110-01-1 |
Melanotan II Acetate | 121062-08-6 | Vapreotide Acetate | 103222-11-3 |
Melanotan I Acetate | 75921-69-6 | Dy norphin A (1-13) | 72957-38-1 |
Secretin Acetate | 17034-35-4 | Leuprolide | 53714-56-0 |
Ornipressin Acetate | 3397-23-7 | Eledoisin Acetate | 69-25-0 |
Oxytocin Acetate | 50-56-6 | GLP-1 (7-37) Acetate | 106612-94-6 |
Lypressin Acetate | 50-57-7 | Pramlintide | Pramlintide |
Nesiritide Acetate | 114471-18-0 | Aviptadil Acetate | 40077-57-4 |
Calcitonin (Salmone) Acetate | 47931-85-1 | Exenatide Acetate | 141732-76-5 |
FAQ
Q1:Can i get free sample ?
A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .
Q2:Which payment method you accept?
A: We accept bank transfer,western union, money gram,bitcoin, USDT,Credit card etc. and more bigger order we accept L/C at sight
Q3: Can i get tracking number after shipment ? and how long does the shipping take?
A: After shipment we will offer you tracking and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery
Q4: How can you guarantee the quality ?
A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.